General Information

  • ID:  hor006657
  • Uniprot ID:  Q23757
  • Protein name:  RPCH-related peptide
  • Gene name:  NA
  • Organism:  Callinectes sapidus (Blue crab)
  • Family:  AKH/HRTH/RPCH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Callinectes (genus), Portuninae (subfamily), Portunidae (family), Portunoidea (superfamily), Heterotremata , Eubrachyura , Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031409 pigment binding
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AAGASGSNGGVGEAVSGLHPSVGGAPGGVVPPGSSSPGDSCGPIPVSAVMHIYRLIRSEAVRLVQCQDEEYLG
  • Length:  73
  • Propeptide:  MVRRSGVTLLVVALLVVTLMSSVSAQLNFSPGWGKRAAGASGSNGGVGEAVSGLHPSVGGAPGGVVPPGSSSPGDSCGPIPVSAVMHIYRLIRSEAVRLVQCQDEEYLG
  • Signal peptide:  MVRRSGVTLLVVALLVVTLMSSVSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  This hormone adapts the animal to light backgrounds by stimulating concentration of the pigment of its red body-chromatophores.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q23757-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006657_AF2.pdbhor006657_ESM.pdb

Physical Information

Mass: 835731 Formula: C302H483N89O101S3
Absent amino acids: FKTW Common amino acids: G
pI: 4.75 Basic residues: 5
Polar residues: 29 Hydrophobic residues: 23
Hydrophobicity: 9.86 Boman Index: -4922
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 82.74
Instability Index: 6323.84 Extinction Coefficient cystines: 3105
Absorbance 280nm: 43.13

Literature

  • PubMed ID:  7611999
  • Title:  A highly conserved red pigment-concentrating hormone precursor in the blue crab Callinectes sapidus.